Reaction Details |
| Report a problem with these data |
Target | Prostaglandin D2 receptor |
---|
Ligand | BDBM50128729 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_157790 (CHEMBL878773) |
---|
IC50 | 180±n/a nM |
---|
Citation | Mitsumori, S; Tsuri, T; Honma, T; Hiramatsu, Y; Okada, T; Hashizume, H; Inagaki, M; Arimura, A; Yasui, K; Asanuma, F; Kishino, J; Ohtani, M Synthesis and biological activity of various derivatives of a novel class of potent, selective, and orally active prostaglandin D2 receptor antagonists. 1. Bicyclo[2.2.1]heptane derivatives. J Med Chem46:2436-45 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin D2 receptor |
---|
Name: | Prostaglandin D2 receptor |
Synonyms: | PD2R_HUMAN | PTGDR | Prostaglandin D2 | Prostaglandin D2 receptor | Prostanoid DP receptor |
Type: | Enzyme |
Mol. Mass.: | 40288.87 |
Organism: | Homo sapiens (Human) |
Description: | Q13258 |
Residue: | 359 |
Sequence: | MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSV
FYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPG
TWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT
RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS
EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
|
|
|
BDBM50128729 |
---|
n/a |
---|
Name | BDBM50128729 |
Synonyms: | (+) 7-[3-(Dibenzothiophene-2-sulfonylamino)-bicyclo[2.2.1]hept-2-yl]-hept-5-enoic acid | CHEMBL312983 |
Type | Small organic molecule |
Emp. Form. | C26H29NO4S2 |
Mol. Mass. | 483.643 |
SMILES | OC(=O)CCC\C=C/C[C@@H]1[C@H]2CC[C@H](C2)[C@H]1NS(=O)(=O)c1ccc2sc3ccccc3c2c1 |
Structure |
|