Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M3
LigandBDBM50129387
Substrate/Competitorn/a
Meas. Tech.ChEBML_138705
Ki 1.4±n/a nM
Citation Ogino YOhtake NKobayashi KKimura TFujikawa THasegawa TNoguchi KMase T Muscarinic M(3) receptor antagonists with (2R)-2-[(1R)-3,3-difluorocyclopentyl]-2-hydroxyphenylacetamide Structures. Part 2. Bioorg Med Chem Lett 13:2167-72 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M3
Name:Muscarinic acetylcholine receptor M1 and M3
Synonyms:CHRM3 | Cholinergic, muscarinic M3 | Muscarinic Receptors M3 | Muscarinic receptor M3 | RecName: Full=Muscarinic acetylcholine receptor M3
Type:Enzyme
Mol. Mass.:66151.03
Organism:Homo sapiens (Human)
Description:P20309
Residue:590
Sequence:
MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPL
GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI
SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR
TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF
YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM
KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE
TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF
PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKR
MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN
PVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50129387
n/a
NameBDBM50129387
Synonyms:(R)-1-(4-Amino-piperidin-1-yl)-2-cyclopentyl-2-hydroxy-2-phenyl-ethanone | CHEMBL71431
TypeSmall organic molecule
Emp. Form.C18H26N2O2
Mol. Mass.302.4112
SMILESNC1CCN(CC1)C(=O)[C@@](O)(C1CCCC1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: