| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50130313 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_138607 (CHEMBL746911) |
|---|
| Ki | 333±n/a nM |
|---|
| Citation |  Pineda, P; Kanter, A; McIvor, RS; Benkovic, SJ; Rosowsky, A; Wagner, CR Dihydrofolate reductase mutant with exceptional resistance to methotrexate but not to trimetrexate. J Med Chem46:2816-8 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_MOUSE | Dhfr |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21608.82 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | n/a |
|---|
| Residue: | 187 |
|---|
| Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
|
|
|
|---|
| BDBM50130313 |
|---|
| n/a |
|---|
| Name | BDBM50130313 |
|---|
| Synonyms: | 2-{4-[(2,4-Diamino-pteridin-6-ylmethyl)-methyl-amino]-benzoylamino}-succinic acid | CHEMBL328499 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H20N8O5 |
|---|
| Mol. Mass. | 440.4127 |
|---|
| SMILES | CN(Cc1cnc2nc(N)nc(N)c2n1)c1ccc(cc1)C(=O)NC(CC(O)=O)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
