Reaction Details |
| Report a problem with these data |
Target | Melanocortin receptor 3 |
---|
Ligand | BDBM50565826 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2093907 (CHEMBL4775170) |
---|
IC50 | 81±n/a nM |
---|
Citation | Martin, C; Gimenez, LE; Williams, SY; Jing, Y; Wu, Y; Hollanders, C; Van der Poorten, O; Gonzalez, S; Van Holsbeeck, K; Previti, S; Lamouroux, A; Zhao, S; Tourwé, D; Stevens, RC; Cone, RD; Ballet, S Structure-Based Design of Melanocortin 4 Receptor Ligands Based on the SHU-9119-hMC4R Cocrystal Structure?. J Med Chem64:357-369 (2021) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Melanocortin receptor 3 |
---|
Name: | Melanocortin receptor 3 |
Synonyms: | MC3-R | MC3R | MC3R_HUMAN | Melanocortin MC3 | Melanocortin receptor (M3 and M4) |
Type: | Enzyme |
Mol. Mass.: | 36044.86 |
Organism: | Homo sapiens (Human) |
Description: | P41968 |
Residue: | 323 |
Sequence: | MNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVI
LAVVRNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIF
DSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVFI
VYSESKMVIVCLITMFFAMMLLMGTLYVHMFLFARLHVKRIAALPPADGVAPQQHSCMKG
AVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYA
FRSLELRNTFREILCGCNGMNLG
|
|
|
BDBM50565826 |
---|
n/a |
---|
Name | BDBM50565826 |
Synonyms: | CHEMBL4794121 |
Type | Small organic molecule |
Emp. Form. | C54H70ClN15O9 |
Mol. Mass. | 1108.682 |
SMILES | CCCC[C@H](NC(C)=O)C(=O)N[C@H]1CC(=O)NCCCC[C@H](NC(=O)[C@H](Cc2c[nH]c3c(Cl)cccc23)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](Cc2ccc3ccccc3c2)NC(=O)[C@H](Cc2cnc[nH]2)NC1=O)C(N)=O |r| |
Structure |
|