| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tumor necrosis factor |
|---|
| Ligand | BDBM50566080 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2094429 (CHEMBL4775692) |
|---|
| IC50 | 7960±n/a nM |
|---|
| Citation |  Dietrich, JD; Longenecker, KL; Wilson, NS; Goess, C; Panchal, SC; Swann, SL; Petros, AM; Hobson, AD; Ihle, D; Song, D; Richardson, P; Comess, KM; Cox, PB; Dombrowski, A; Sarris, K; Donnelly-Roberts, DL; Duignan, DB; Gomtsyan, A; Jung, P; Krueger, AC; Mathieu, S; McClure, A; Stoll, VS; Wetter, J; Mankovich, JA; Hajduk, PJ; Vasudevan, A; Stoffel, RH; Sun, C Development of Orally Efficacious Allosteric Inhibitors of TNF? via Fragment-Based Drug Design. J Med Chem64:417-429 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tumor necrosis factor |
|---|
| Name: | Tumor necrosis factor |
|---|
| Synonyms: | Cachectin | TNF | TNF-a | TNF-alpha | TNFA | TNFA_HUMAN | TNFSF2 | Tumor necrosis factor (TNF-alpha) | Tumor necrosis factor (TNFa) | Tumor necrosis factor alpha (TNFα) | Tumor necrosis factor ligand superfamily member 2 | Tumor necrosis factor, membrane form | Tumor necrosis factor, soluble form | tumor necrosis factor alpha |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 25645.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P01375 |
|---|
| Residue: | 233 |
|---|
| Sequence: | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
|
|
|
|---|
| BDBM50566080 |
|---|
| n/a |
|---|
| Name | BDBM50566080 |
|---|
| Synonyms: | CHEMBL4783333 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H12N2 |
|---|
| Mol. Mass. | 244.2906 |
|---|
| SMILES | N#CCc1ccc(cc1)-c1cccc2ccncc12 |
|---|
| Structure | 
|
|---|
Search and Browse
