Reaction Details |
| Report a problem with these data |
Target | Peptide deformylase, mitochondrial |
---|
Ligand | BDBM50131290 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_154178 |
---|
IC50 | 8±n/a nM |
---|
Citation | Davies, SJ; Ayscough, AP; Beckett, RP; Bragg, RA; Clements, JM; Doel, S; Grew, C; Launchbury, SB; Perkins, GM; Pratt, LM; Smith, HK; Spavold, ZM; Thomas, SW; Todd, RS; Whittaker, M Structure-activity relationships of the peptide deformylase inhibitor BB-3497: modification of the methylene spacer and the P1' side chain. Bioorg Med Chem Lett13:2709-13 (2003) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptide deformylase, mitochondrial |
---|
Name: | Peptide deformylase, mitochondrial |
Synonyms: | DEFM_HUMAN | PDF | PDF1A | Peptide deformylase mitochondrial | Peptide deformylase, mitochondrial | Polypeptide deformylase |
Type: | PROTEIN |
Mol. Mass.: | 27023.25 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_154318 |
Residue: | 243 |
Sequence: | MARLWGALSLWPLWAAVPWGGAAAVGVRACSSTAAPDGVEGPALRRSYWRHLRRLVLGPP
EPPFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPR
QVLALELPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLA
CVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMK
VND
|
|
|
BDBM50131290 |
---|
n/a |
---|
Name | BDBM50131290 |
Synonyms: | (S)-2-[(R)-2-Cyclopentylmethyl-3-(formyl-hydroxy-amino)-propionylamino]-3,3,N,N-tetramethyl-butyramide | CHEMBL316099 |
Type | Small organic molecule |
Emp. Form. | C18H33N3O4 |
Mol. Mass. | 355.4723 |
SMILES | CN(C)C(=O)[C@@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(C)(C)C |
Structure |
|