Reaction Details |
| Report a problem with these data |
Target | Ileal sodium/bile acid cotransporter |
---|
Ligand | BDBM50134407 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_35875 |
---|
IC50 | 2500±n/a nM |
---|
Citation | Tollefson, MB; Kolodziej, SA; Fletcher, TR; Vernier, WF; Beaudry, JA; Keller, BT; Reitz, DB A novel class of apical sodium co-dependent bile acid transporter inhibitors: the 1,2-benzothiazepines. Bioorg Med Chem Lett13:3727-30 (2003) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Ileal sodium/bile acid cotransporter |
---|
Name: | Ileal sodium/bile acid cotransporter |
Synonyms: | ASBT | Apical sodium-dependent bile acid transporter | IBAT | ISBT | Ileal Na(+)/bile acid cotransporter | Ileal bile acid transporter | Ileal bile acid transporter/bile acid cotransporter | Ileal sodium-dependent bile acid transporter | NTCP2 | NTCP2_HUMAN | SLC10A2 |
Type: | Enzyme |
Mol. Mass.: | 37714.89 |
Organism: | Homo sapiens (Human) |
Description: | SLC10A2 |
Residue: | 348 |
Sequence: | MNDPNSCVDNATVCSGASCVVPESNFNNILSVVLSTVLTILLALVMFSMGCNVEIKKFLG
HIKRPWGICVGFLCQFGIMPLTGFILSVAFDILPLQAVVVLIIGCCPGGTASNILAYWVD
GDMDLSVSMTTCSTLLALGMMPLCLLIYTKMWVDSGSIVIPYDNIGTSLVSLVVPVSIGM
FVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWIIAPKLWIIGTIFPVAGYSL
GFLLARIAGLPWYRCRTVAFETGMQNTQLCSTIVQLSFTPEELNVVFTFPLIYSIFQLAF
AAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK
|
|
|
BDBM50134407 |
---|
n/a |
---|
Name | BDBM50134407 |
Synonyms: | (8R,9R)-6-Benzyl-7,7-dibutyl-2-dimethylamino-9-(3-ethylamino-phenyl)-5,5-dioxo-6,7,8,9-tetrahydro-5H-5lambda*6*-thia-6-aza-benzocyclohepten-8-ol | CHEMBL332606 |
Type | Small organic molecule |
Emp. Form. | C34H47N3O3S |
Mol. Mass. | 577.82 |
SMILES | CCCCC1(CCCC)[C@H](O)[C@H](c2cccc(NCC)c2)c2cc(ccc2S(=O)(=O)N1Cc1ccccc1)N(C)C |
Structure |
|