| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ileal sodium/bile acid cotransporter |
|---|
| Ligand | BDBM50134416 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_35875 |
|---|
| IC50 | 1.6±n/a nM |
|---|
| Citation |  Tollefson, MB; Kolodziej, SA; Fletcher, TR; Vernier, WF; Beaudry, JA; Keller, BT; Reitz, DB A novel class of apical sodium co-dependent bile acid transporter inhibitors: the 1,2-benzothiazepines. Bioorg Med Chem Lett13:3727-30 (2003) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Ileal sodium/bile acid cotransporter |
|---|
| Name: | Ileal sodium/bile acid cotransporter |
|---|
| Synonyms: | ASBT | Apical sodium-dependent bile acid transporter | IBAT | ISBT | Ileal Na(+)/bile acid cotransporter | Ileal bile acid transporter | Ileal bile acid transporter/bile acid cotransporter | Ileal sodium-dependent bile acid transporter | NTCP2 | NTCP2_HUMAN | SLC10A2 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 37714.89 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | SLC10A2 |
|---|
| Residue: | 348 |
|---|
| Sequence: | MNDPNSCVDNATVCSGASCVVPESNFNNILSVVLSTVLTILLALVMFSMGCNVEIKKFLG
HIKRPWGICVGFLCQFGIMPLTGFILSVAFDILPLQAVVVLIIGCCPGGTASNILAYWVD
GDMDLSVSMTTCSTLLALGMMPLCLLIYTKMWVDSGSIVIPYDNIGTSLVSLVVPVSIGM
FVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWIIAPKLWIIGTIFPVAGYSL
GFLLARIAGLPWYRCRTVAFETGMQNTQLCSTIVQLSFTPEELNVVFTFPLIYSIFQLAF
AAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK
|
|
|
|---|
| BDBM50134416 |
|---|
| n/a |
|---|
| Name | BDBM50134416 |
|---|
| Synonyms: | CHEMBL332974 | Trifluoro-acetate{4-[3-((8R,9R)-7,7-dibutyl-2-dimethylamino-8-hydroxy-5,5-dioxo-6,7,8,9-tetrahydro-5H-5lambda*6*-thia-6-aza-benzocyclohepten-9-yl)-phenylcarbamoyl]-butyl}-triethyl-ammonium; |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C36H59N4O4S |
|---|
| Mol. Mass. | 643.943 |
|---|
| SMILES | CCCCC1(CCCC)NS(=O)(=O)c2ccc(cc2[C@H]([C@H]1O)c1cccc(NC(=O)CCCC[N+](CC)(CC)CC)c1)N(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
