Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 1D |
---|
Ligand | BDBM50136462 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_1724 |
---|
Ki | 3.4±n/a nM |
---|
Citation | Isaac, M; Slassi, M; Xin, T; Arora, J; O'Brien, A; Edwards, L; MacLean, N; Wilson, J; Demschyshyn, L; Labrie, P; Naismith, A; Maddaford, S; Papac, D; Harrison, S; Wang, H; Draper, S; Tehim, A Design, synthesis and biological activity of novel dimethyl-[2-[6-substituted-indol-1-yl]-ethyl]-amine as potent, selective, and orally-bioavailable 5-HT(1D) agonists. Bioorg Med Chem Lett13:4409-13 (2003) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 1D |
---|
Name: | 5-hydroxytryptamine receptor 1D |
Synonyms: | 5-HT-1D | 5-HT-1D-alpha | 5-HT1D | 5-hydroxytryptamine receptor 1D (5-HT1D) | 5HT1D_HUMAN | HTR1D | HTR1DA | HTRL | Serotonin (5-HT) receptor | Serotonin Receptor 1D |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 41920.63 |
Organism: | Homo sapiens (Human) |
Description: | Receptor binding assays were performed using human clone stably expressed in CHO cells. |
Residue: | 377 |
Sequence: | MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAK
AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFT
TAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT
KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFQKIVPFRKAS
|
|
|
BDBM50136462 |
---|
n/a |
---|
Name | BDBM50136462 |
Synonyms: | 4-[1-(2-Dimethylamino-ethyl)-1H-indol-6-yl]-tetrahydro-pyran-4-ol | CHEMBL139801 |
Type | Small organic molecule |
Emp. Form. | C17H24N2O2 |
Mol. Mass. | 288.3847 |
SMILES | CN(C)CCn1ccc2ccc(cc12)C1(O)CCOCC1 |
Structure |
|