| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Aldo-keto reductase family 1 member B1 |
|---|
| Ligand | BDBM16314 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_31909 (CHEMBL642953) |
|---|
| IC50 | 16000±n/a nM |
|---|
| Citation |  Sun, WS; Park, YS; Yoo, J; Park, KD; Kim, SH; Kim, JH; Park, HJ Rational design of an indolebutanoic acid derivative as a novel aldose reductase inhibitor based on docking and 3D QSAR studies of phenethylamine derivatives. J Med Chem46:5619-27 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Aldo-keto reductase family 1 member B1 |
|---|
| Name: | Aldo-keto reductase family 1 member B1 |
|---|
| Synonyms: | AKR1B1 | ALDR_PIG | ALR2 | AR | Aldose reductase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 35865.31 |
|---|
| Organism: | Sus scrofa |
|---|
| Description: | ChEMBL_502637 |
|---|
| Residue: | 316 |
|---|
| Sequence: | MASHLVLYTGAKMPILGLGTWKSPPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLGLQ
EKLQGQVVKREDLFIVSKLWCTDHEKNLVKGACQTTLRDLKLDYLDLYLIHWPTGFKPGK
DPFPLDGDGNVVPDESDFVETWEAMEELVDEGLVKAIGVSNFNHLQVEKILNKPGLKYKP
AVNQIEVHPYLTQEKLIEYCKSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK
YNKTTAQVLIRFPMQRNLIVIPKSVTPERIAENFQVFDFELSPEDMNTLLSYNRNWRVCA
LMSCASHKDYPFHEEY
|
|
|
|---|
| BDBM16314 |
|---|
| n/a |
|---|
| Name | BDBM16314 |
|---|
| Synonyms: | 2-{[6-methoxy-5-(trifluoromethyl)naphthalen-1-yl]-N-methylmethanethioamido}acetic acid | Alredase | CHEMBL436 | N-{[6-methoxy-5-(trifluoromethyl)naphthalen-1-yl]carbonothioyl}-N-methylglycine | Tolrestat |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H14F3NO3S |
|---|
| Mol. Mass. | 357.347 |
|---|
| SMILES | COc1ccc2c(cccc2c1C(F)(F)F)C(=S)N(C)CC(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
