Reaction Details |
| Report a problem with these data |
Target | Adenosine receptor A1 |
---|
Ligand | BDBM50138543 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_29728 |
---|
Ki | 148±n/a nM |
---|
Citation | Palle, VP; Varkhedkar, V; Ibrahim, P; Ahmed, H; Li, Z; Gao, Z; Ozeck, M; Wu, Y; Zeng, D; Wu, L; Leung, K; Chu, N; Zablocki, JA Affinity and intrinsic efficacy (IE) of 5'-carbamoyl adenosine analogues for the A1 adenosine receptor--efforts towards the discovery of a chronic ventricular rate control agent for the treatment of atrial fibrillation (AF). Bioorg Med Chem Lett14:535-9 (2003) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Adenosine receptor A1 |
---|
Name: | Adenosine receptor A1 |
Synonyms: | A1 adenosine receptor (hA1) | A1AR | AA1R_HUMAN | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT) |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 36520.92 |
Organism: | Homo sapiens (Human) |
Description: | P30542 |
Residue: | 326 |
Sequence: | MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
|
|
|
BDBM50138543 |
---|
n/a |
---|
Name | BDBM50138543 |
Synonyms: | CHEMBL150944 | Cyclobutyl-thiocarbamic acid (2R,3S,4R)-3,4-dihydroxy-5-{6-[(R)-(tetrahydro-furan-3-yl)amino]-purin-9-yl}-tetrahydro-furan-2-ylmethyl ester |
Type | Small organic molecule |
Emp. Form. | C19H26N6O5S |
Mol. Mass. | 450.512 |
SMILES | O[C@@H]1[C@@H](COC(=S)NC2CCC2)OC([C@@H]1O)n1cnc2c(NC3CCOC3)ncnc12 |
Structure |
|