Reaction Details |
| Report a problem with these data |
Target | Adenosine receptor A1 |
---|
Ligand | BDBM50138545 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_29007 |
---|
Ki | 70±n/a nM |
---|
Citation | Palle, VP; Varkhedkar, V; Ibrahim, P; Ahmed, H; Li, Z; Gao, Z; Ozeck, M; Wu, Y; Zeng, D; Wu, L; Leung, K; Chu, N; Zablocki, JA Affinity and intrinsic efficacy (IE) of 5'-carbamoyl adenosine analogues for the A1 adenosine receptor--efforts towards the discovery of a chronic ventricular rate control agent for the treatment of atrial fibrillation (AF). Bioorg Med Chem Lett14:535-9 (2003) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Adenosine receptor A1 |
---|
Name: | Adenosine receptor A1 |
Synonyms: | AA1R_RAT | ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | Adenosine A1 receptor (A1) | Adenosine receptor | Adenosine receptors A1 | Adora1 |
Type: | Protein |
Mol. Mass.: | 36704.13 |
Organism: | Rattus norvegicus (rat) |
Description: | n/a |
Residue: | 326 |
Sequence: | MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
|
|
|
BDBM50138545 |
---|
n/a |
---|
Name | BDBM50138545 |
Synonyms: | (3R,4S,5R)-2-(6-Cyclopentylamino-purin-9-yl)-5-methyl-tetrahydro-furan-3,4-diol | 2-(6-Cyclopentylamino-purin-9-yl)-5-methyl-tetrahydro-furan-3,4-diol | CHEMBL150197 |
Type | Small organic molecule |
Emp. Form. | C15H21N5O3 |
Mol. Mass. | 319.3589 |
SMILES | C[C@H]1OC([C@H](O)[C@@H]1O)n1cnc2c(NC3CCCC3)ncnc12 |
Structure |
|