| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase FKBP1B |
|---|
| Ligand | BDBM50575648 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2125783 (CHEMBL4835128) |
|---|
| Kd | 446±n/a nM |
|---|
| Citation |  Bauder, M; Meyners, C; Purder, PL; Merz, S; Sugiarto, WO; Voll, AM; Heymann, T; Hausch, F Structure-Based Design of High-Affinity Macrocyclic FKBP51 Inhibitors. J Med Chem64:3320-3349 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase FKBP1B |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase FKBP1B |
|---|
| Synonyms: | 12.6 kDa FKBP | FK506-binding protein 1B | FKB1B_HUMAN | FKBP-12.6 | FKBP-1B | FKBP12.6 | FKBP1B | FKBP1L | FKBP9 | Immunophilin FKBP12.6 | OTK4 | PPIase FKBP1B | Peptidyl-prolyl cis-trans isomerase FKBP1B | Rotamase | h-FKBP-12 | mTOR/FKBP12A/FKBP12B |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 11785.40 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1458980 |
|---|
| Residue: | 108 |
|---|
| Sequence: | MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGF
EEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
|
|
|
|---|
| BDBM50575648 |
|---|
| n/a |
|---|
| Name | BDBM50575648 |
|---|
| Synonyms: | CHEMBL4848201 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C42H53NO9 |
|---|
| Mol. Mass. | 715.8715 |
|---|
| SMILES | COc1ccc(CC[C@H]2OC(=O)[C@@H]3CCCCN3C(=O)[C@@H](C3CCCCC3)c3cc(OC)c(OCCCOc4cccc2c4)c(OC)c3)cc1OC |r| |
|---|
| Structure | 
|
|---|
Search and Browse
