Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosylhomocysteinase
LigandBDBM50006215
Substrate/Competitorn/a
Meas. Tech.ChEBML_196739
IC50 8700±n/a nM
Citation Kim HOYoo SJAhn HSChoi WJMoon HRLee KMChun MWJeong LS Synthesis of fluorinated cyclopentenyladenine as potent inhibitor of S-adenosylhomocysteine hydrolase. Bioorg Med Chem Lett 14:2091-3 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosylhomocysteinase
Name:Adenosylhomocysteinase
Synonyms:Adenosylhomocysteinase
Type:PROTEIN
Mol. Mass.:47714.06
Organism:Homo sapiens (Human)
Description:ChEMBL_1507791
Residue:432
Sequence:
MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVET
AVLIETLVTLGAEVQWSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYF
KDGPLNMILDDGGDLTNLIHTKYPQLLPGIRGISEETTTGVHNLYKMMANGILKVPAINV
NDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVI
ITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIG
HFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSN
SFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMS
CDGPFKPDHYRY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50006215
n/a
NameBDBM50006215
Synonyms:(1'R,2'S,3'R)-9-(2',3'-dihydroxycyclopent-4'-enyl)adenine | (1S,2R,5R)-5-(6-Amino-purin-9-yl)-cyclopent-3-ene-1,2-diol | 5-(6-Amino-purin-9-yl)-cyclopent-3-ene-1,2-diol | CHEMBL299961
TypeSmall organic molecule
Emp. Form.C10H11N5O2
Mol. Mass.233.2266
SMILESNc1ncnc2n(cnc12)[C@@H]1C=C[C@@H](O)[C@H]1O |c:13|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: