Reaction Details |
| Report a problem with these data |
Target | Integrase |
---|
Ligand | BDBM23399 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_90550 (CHEMBL701900) |
---|
IC50 | 14500±n/a nM |
---|
Citation | Long, YQ; Jiang, XH; Dayam, R; Sanchez, T; Shoemaker, R; Sei, S; Neamati, N Rational design and synthesis of novel dimeric diketoacid-containing inhibitors of HIV-1 integrase: implication for binding to two metal ions on the active site of integrase. J Med Chem47:2561-73 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Integrase |
---|
Name: | Integrase |
Synonyms: | Human immunodeficiency virus type 1 integrase |
Type: | PROTEIN |
Mol. Mass.: | 32231.48 |
Organism: | Human immunodeficiency virus 1 |
Description: | ChEMBL_90865 |
Residue: | 288 |
Sequence: | FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED
|
|
|
BDBM23399 |
---|
n/a |
---|
Name | BDBM23399 |
Synonyms: | 4-{1-[(4-fluorophenyl)methyl]-1H-pyrrol-2-yl}-2,4-dioxobutanoic acid | CHEMBL421353 | CHEMBL50605 | L-731988 |
Type | Small organic molecule |
Emp. Form. | C15H12FNO4 |
Mol. Mass. | 289.2585 |
SMILES | OC(=O)C(=O)CC(=O)c1cccn1Cc1ccc(F)cc1 |
Structure |
|