| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50150810 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_305297 (CHEMBL832845) |
|---|
| IC50 | >10000±n/a nM |
|---|
| Citation |  Balboni, G; Salvadori, S; Guerrini, R; Negri, L; Giannini, E; Bryant, SD; Jinsmaa, Y; Lazarus, LH Direct influence of C-terminally substituted amino acids in the Dmt-Tic pharmacophore on delta-opioid receptor selectivity and antagonism. J Med Chem47:4066-71 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50150810 |
|---|
| n/a |
|---|
| Name | BDBM50150810 |
|---|
| Synonyms: | (R)-2-({2-[2-Amino-3-(4-hydroxy-2,6-dimethyl-phenyl)-propionyl]-1,2,3,4-tetrahydro-isoquinoline-3-carbonyl}-amino)-3-(1H-imidazol-4-yl)-propionic acid | CHEMBL184875 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H31N5O5 |
|---|
| Mol. Mass. | 505.5655 |
|---|
| SMILES | Cc1cc(O)cc(C)c1CC(N)C(=O)N1Cc2ccccc2CC1C(=O)NC(Cc1cnc[nH]1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
