| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta |
|---|
| Ligand | BDBM50583528 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2157652 (CHEMBL5042312) |
|---|
| Ki | >1000±n/a nM |
|---|
| Citation |  Guo, M; He, S; Cheng, J; Li, Y; Dong, G; Sheng, C Hydrophobic Tagging-Induced Degradation of PDE? in Colon Cancer Cells. ACS Med Chem Lett13:298-303 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta |
|---|
| Name: | Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta |
|---|
| Synonyms: | 3',5'-cyclic phosphodiesterase | GMP-PDE delta | PDE6D | PDE6D_HUMAN | PDED | Protein p17 | Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 17418.30 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_105761 |
|---|
| Residue: | 150 |
|---|
| Sequence: | MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVS
RELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPA
SVLTGNVIIETKFFDDDLLVSTSRVRLFYV
|
|
|
|---|
| BDBM50583528 |
|---|
| n/a |
|---|
| Name | BDBM50583528 |
|---|
| Synonyms: | CHEMBL5092958 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C48H65N7O4 |
|---|
| Mol. Mass. | 804.0742 |
|---|
| SMILES | Cc1n(nc2c1c(C)nn(CCCC(=O)NCCc1ccc(NC(=O)CCCCCCCCCC(=O)NCC34CC5CC(CC(C5)C3)C4)cc1)c2=O)-c1ccc(C)cc1 |TLB:41:42:39.40.45:46,THB:41:40:46:47.42.43,43:42:39:45.44.46,43:44:39:47.41.42| |
|---|
| Structure | 
|
|---|
Search and Browse
