Reaction Details |
| Report a problem with these data |
Target | Fatty acid-binding protein, intestinal |
---|
Ligand | BDBM50152853 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_305929 (CHEMBL833476) |
---|
IC50 | >100000±n/a nM |
---|
Citation | Lehmann, F; Haile, S; Axen, E; Medina, C; Uppenberg, J; Svensson, S; Lundbäck, T; Rondahl, L; Barf, T Discovery of inhibitors of human adipocyte fatty acid-binding protein, a potential type 2 diabetes target. Bioorg Med Chem Lett14:4445-8 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fatty acid-binding protein, intestinal |
---|
Name: | Fatty acid-binding protein, intestinal |
Synonyms: | FABP2 | FABPI | FABPI_HUMAN | Fatty acid binding protein intestinal | Fatty acid-binding protein, intestinal | I-FABP | Intestinal fatty acid-binding protein (hIFABP) |
Type: | Protein |
Mol. Mass.: | 15207.56 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 132 |
Sequence: | MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIE
VVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVY
EGVEAKRIFKKD
|
|
|
BDBM50152853 |
---|
n/a |
---|
Name | BDBM50152853 |
Synonyms: | 2-(Carbazole-9-sulfonyl)-benzoic acid | CHEMBL364141 |
Type | Small organic molecule |
Emp. Form. | C19H13NO4S |
Mol. Mass. | 351.376 |
SMILES | OC(=O)c1ccccc1S(=O)(=O)n1c2ccccc2c2ccccc12 |
Structure |
|