| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fatty acid-binding protein, intestinal |
|---|
| Ligand | BDBM50152852 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_305929 (CHEMBL833476) |
|---|
| IC50 | 3900±n/a nM |
|---|
| Citation |  Lehmann, F; Haile, S; Axen, E; Medina, C; Uppenberg, J; Svensson, S; Lundbäck, T; Rondahl, L; Barf, T Discovery of inhibitors of human adipocyte fatty acid-binding protein, a potential type 2 diabetes target. Bioorg Med Chem Lett14:4445-8 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fatty acid-binding protein, intestinal |
|---|
| Name: | Fatty acid-binding protein, intestinal |
|---|
| Synonyms: | FABP2 | FABPI | FABPI_HUMAN | Fatty acid binding protein intestinal | Fatty acid-binding protein, intestinal | I-FABP | Intestinal fatty acid-binding protein (hIFABP) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 15207.56 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 132 |
|---|
| Sequence: | MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIE
VVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVY
EGVEAKRIFKKD
|
|
|
|---|
| BDBM50152852 |
|---|
| n/a |
|---|
| Name | BDBM50152852 |
|---|
| Synonyms: | 3-(5-Bromo-indole-1-sulfonyl)-thiophene-2-carboxylic acid | CHEMBL427320 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H8BrNO4S2 |
|---|
| Mol. Mass. | 386.241 |
|---|
| SMILES | OC(=O)c1sccc1S(=O)(=O)n1ccc2cc(Br)ccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
