Reaction Details |
| Report a problem with these data |
Target | Corticotropin-releasing factor receptor 1 |
---|
Ligand | BDBM50155977 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_306679 (CHEMBL830013) |
---|
IC50 | 3.3±n/a nM |
---|
Citation | Dzierba, CD; Takvorian, AG; Rafalski, M; Kasireddy-Polam, P; Wong, H; Molski, TF; Zhang, G; Li, YW; Lelas, S; Peng, Y; McElroy, JF; Zaczek, RC; Taub, RA; Combs, AP; Gilligan, PJ; Trainor, GL Synthesis, structure-activity relationships, and in vivo properties of 3,4-dihydro-1H-pyrido[2,3-b]pyrazin-2-ones as corticotropin-releasing factor-1 receptor antagonists. J Med Chem47:5783-90 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Corticotropin-releasing factor receptor 1 |
---|
Name: | Corticotropin-releasing factor receptor 1 |
Synonyms: | CRF-R | CRF1 | CRFR1_RAT | CRH-R 1 | Corticotropin releasing factor receptor | Corticotropin releasing factor receptor 1 | Corticotropin-releasing Factor Receptor 1 | Corticotropin-releasing hormone receptor 1 | Crhr | Crhr1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 47870.75 |
Organism: | Rattus norvegicus (rat) |
Description: | Receptor binding assays were performed using rat cortex homogenate. |
Residue: | 415 |
Sequence: | MGRRPQLRLVKALLLLGLNPVSTSLQDQRCENLSLTSNVSGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
IINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEV
HQSNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPF
PIIVAWAIGKLHYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA
STTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVS
VFYCFLNSEVRSAIRKRWRRWQDKHSIRARVARAMSIPTSPTRVSFHSIKQSTAV
|
|
|
BDBM50155977 |
---|
n/a |
---|
Name | BDBM50155977 |
Synonyms: | 4-[8-(Butyl-ethyl-amino)-6-methyl-2-oxo-2,3-dihydro-1H-pyrido[2,3-b]pyrazin-4-yl]-3,5-dichloro-benzonitrile; TFA | CHEMBL187410 |
Type | Small organic molecule |
Emp. Form. | C21H23Cl2N5O |
Mol. Mass. | 432.346 |
SMILES | CCCCN(CC)c1cc(C)nc2N(CC(=O)Nc12)c1c(Cl)cc(cc1Cl)C#N |
Structure |
|