Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBradykinin B1 receptor
LigandBDBM50157518
Substrate/Competitorn/a
Meas. Tech.ChEMBL_429973
Ki 0.8±n/a nM
Citation Kuduk SDNg CFeng DMWai JMChang RSHarrell CMMurphy KLRansom RWReiss DIvarsson MMason GBoyce STang CPrueksaritanont TFreidinger RMPettibone DJBock MG 2,3-diaminopyridine bradykinin B1 receptor antagonists. J Med Chem 47:6439-42 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bradykinin B1 receptor
Name:Bradykinin B1 receptor
Synonyms:B1 BRADYKININ | B1 bradykinin receptor | B1R | BK-1 receptor
Type:Enzyme
Mol. Mass.:40508.87
Organism:Homo sapiens (Human)
Description:P46663
Residue:353
Sequence:
MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50157518
n/a
NameBDBM50157518
Synonyms:5-chloro-4'-{(R)-1-[4-chloro-3-(2-cyano-acetylamino)-pyridin-2-ylamino]-ethyl}-biphenyl-2-carboxylic acid methyl ester | CHEMBL375288
TypeSmall organic molecule
Emp. Form.C24H20Cl2N4O3
Mol. Mass.483.347
SMILESCOC(=O)c1ccc(Cl)cc1-c1ccc(cc1)[C@@H](C)Nc1nccc(Cl)c1NC(=O)CC#N |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: