| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM22041 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2191886 (CHEMBL5104246) |
|---|
| Ki | 0.500000±n/a nM |
|---|
| Citation |  Barresi, E; Robello, M; Costa, B; Da Pozzo, E; Baglini, E; Salerno, S; Da Settimo, F; Martini, C; Taliani, S An update into the medicinal chemistry of translocator protein (TSPO) ligands. Eur J Med Chem209:0 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18834.74 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30536 |
|---|
| Residue: | 169 |
|---|
| Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
|---|
| BDBM22041 |
|---|
| n/a |
|---|
| Name | BDBM22041 |
|---|
| Synonyms: | 2-[6-chloro-2-(4-chlorophenyl)imidazo[1,2-a]pyridin-3-yl]-N,N-dipropylacetamide | Alpidem | Ananxyl | CHEMBL54349 | S-800342 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H23Cl2N3O |
|---|
| Mol. Mass. | 404.333 |
|---|
| SMILES | CCCN(CCC)C(=O)Cc1c(nc2ccc(Cl)cn12)-c1ccc(Cl)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
