| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tubulin beta chain [1-43] |
|---|
| Ligand | BDBM50160800 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_311916 (CHEMBL834683) |
|---|
| IC50 | 30000±n/a nM |
|---|
| Citation |  Morita, H; Koyama, K; Sugimoto, Y; Kobayashi, J Antimitotic activity and reversal of breast cancer resistance protein-mediated drug resistance by stilbenoids from Bletilla striata. Bioorg Med Chem Lett15:1051-4 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tubulin beta chain [1-43] |
|---|
| Name: | Tubulin beta chain [1-43] |
|---|
| Synonyms: | Beta tubulin | TBB_LEIME |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 4652.47 |
|---|
| Organism: | Leishmania donovani |
|---|
| Description: | ChEMBL_311916 |
|---|
| Residue: | 43 |
|---|
| Sequence: | MREIVSCQAGQCGNQIGSKFWEVIADEHGVDPTGSYQGDSDLQ
|
|
|
|---|
| BDBM50160800 |
|---|
| n/a |
|---|
| Name | BDBM50160800 |
|---|
| Synonyms: | 1,3-Bis-(4-hydroxy-benzyl)-4-methoxy-9,10-dihydro-phenanthrene-2,7-diol | CHEMBL181587 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H26O5 |
|---|
| Mol. Mass. | 454.5137 |
|---|
| SMILES | COc1c(Cc2ccc(O)cc2)c(O)c(Cc2ccc(O)cc2)c2CCc3cc(O)ccc3-c12 |
|---|
| Structure | 
|
|---|
Search and Browse
