Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase C alpha type
LigandBDBM4814
Substrate/Competitorn/a
Meas. Tech.ChEMBL_325074
Kd 6000±n/a nM
Citation Fabian MABiggs WHTreiber DKAtteridge CEAzimioara MDBenedetti MGCarter TACiceri PEdeen PTFloyd MFord JMGalvin MGerlach JLGrotzfeld RMHerrgard SInsko DEInsko MALai AGLélias JMMehta SAMilanov ZVVelasco AMWodicka LMPatel HKZarrinkar PPLockhart DJ A small molecule-kinase interaction map for clinical kinase inhibitors. Nat Biotechnol 23:329-36 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein kinase C alpha type
Name:PKC alpha and beta-2
Synonyms:PKC alpha | PKC-A | PKC-alpha | Protein Kinase C- alpha | Protein kinase C alpha | Protein kinase C alpha (PKCa) | Protein kinase C alpha type (PKC-A) | Protein kinase C alpha type (PRKCA) | Proto-oncogene c-RAF | RAF proto-oncogene serine/threonine-protein kinase
Type:Enzyme
Mol. Mass.:76755.65
Organism:Homo sapiens (Human)
Description:The recombinant human PKC enzymes were produced using a baculovirus expression system in SF9 cells
Residue:672
Sequence:
MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM4814
n/a
NameBDBM4814
Synonyms:CHEMBL535 | N-[2-(diethylamino)ethyl]-5-[(Z)-(5-fluoro-2-oxo-1,2-dihydro-3H-indol-3-ylidene)methyl]-2,4-dimethyl-1H-pyrrole-3-carboxamide | N-[2-(diethylamino)ethyl]-5-{[(3Z)-5-fluoro-2-oxo-2,3-dihydro-1H-indol-3-ylidene]methyl}-2,4-dimethyl-1H-pyrrole-3-carboxamide | SU11248 | SUNITINIB | SUNITINIB MALATE | US9163010, Sunitinib
TypeSmall organic molecule
Emp. Form.C22H27FN4O2
Mol. Mass.398.4738
SMILESCCN(CC)CCNC(=O)c1c(C)[nH]c(\C=C2/C(=O)Nc3ccc(F)cc23)c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: