Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-C chemokine receptor type 3
LigandBDBM50163634
Substrate/Competitorn/a
Meas. Tech.ChEMBL_306855
IC50 20±n/a nM
Citation De Lucca GVKim UTVargo BJDuncia JVSantella JBGardner DSZheng CLiauw AWang ZEmmett GWacker DAWelch PKCovington MStowell NCWadman EADas AMDavies PYeleswaram SGraden DMSolomon KANewton RCTrainor GLDecicco CPKo SS Discovery of CC chemokine receptor-3 (CCR3) antagonists with picomolar potency. J Med Chem 48:2194-211 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-C chemokine receptor type 3
Name:C-C chemokine receptor type 3
Synonyms:C-C CKR-3 | CC-CKR-3 | CCR-3 | CCR3 | CD_antigen=CD193 | CKR3 | MIP-1 alpha RL2 | Macrophage inflammatory protein 1-alpha receptor-like 2 | Probable C-C chemokine receptor type 3
Type:PROTEIN
Mol. Mass.:41791.57
Organism:Mus musculus
Description:ChEMBL_1445729
Residue:359
Sequence:
MAFNTDEIKTVVESFETTPYEYEWAPPCEKVRIKELGSWLLPPLYSLVFIIGLLGNMMVV
LILIKYRKLQIMTNIYLFNLAISDLLFLFTVPFWIHYVLWNEWGFGHYMCKMLSGFYYLA
LYSEIFFIILLTIDRYLAIVHAVFALRARTVTFATITSIITWGLAGLAALPEFIFHESQD
SFGEFSCSPRYPEGEEDSWKRFHALRMNIFGLALPLLIMVICYSGIIKTLLRCPNKKKHK
AIRLIFVVMIVFFIFWTPYNLVLLFSAFHSTFLETSCQQSKHLDLAMQVTEVIAYTHCCI
NPVIYAFVGERFRKHLRLFFHRNVAVYLGKYIPFLPGEKMERTSSVSPSTGEQEISVVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50163634
n/a
NameBDBM50163634
Synonyms:1-((1R,2S)-2-(((S)-3-(4-fluorobenzyl)piperidin-1-yl)methyl)cyclohexyl)-3-(3-(1-methyl-1H-tetrazol-5-yl)phenyl)urea | 1-{(1R,2S)-2-[(S)-3-(4-Fluoro-benzyl)-piperidin-1-ylmethyl]-cyclohexyl}-3-[3-(1-methyl-1H-tetrazol-5-yl)-phenyl]-urea | CHEMBL363840
TypeSmall organic molecule
Emp. Form.C28H36FN7O
Mol. Mass.505.6301
SMILESCn1nnnc1-c1cccc(NC(=O)N[C@@H]2CCCC[C@H]2CN2CCC[C@@H](Cc3ccc(F)cc3)C2)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: