Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTransglutaminase-1 (TG1)
LigandBDBM50164222
Substrate/Competitorn/a
Meas. Tech.ChEMBL_304809
IC50 8100±n/a nM
Citation Leung-Toung RTam TFWodzinska JMZhao YLowrie JSimpson CDKarimian KSpino M 3-Substituted imidazo[1,2-d][1,2,4]-thiadiazoles: a novel class of factor XIIIa inhibitors. J Med Chem 48:2266-9 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Transglutaminase-1 (TG1)
Name:Transglutaminase-1 (TG1)
Synonyms:Protein-glutamine gamma-glutamyltransferase K
Type:Protein
Mol. Mass.:89778.63
Organism:Homo sapiens (Human)
Description:n/a
Residue:817
Sequence:
MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDGRSRRGGGRSFWARCCGCCSCRNAADDD
WGPEPSDSRGRGSSSGTRRPGSRGSDSRRPVSRGSGVNAAGDGTIREGMLVVNGVDLLSS
RSDQNRREHHTDEYEYDELIVRRGQPFHMLLLLSRTYESSDRITLELLIGNNPEVGKGTH
VIIPVGKGGSGGWKAQVVKASGQNLNLRVHTSPNAIIGKFQFTVRTQSDAGEFQLPFDPR
NEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDA
CLYILDRRGMPYGGRGDPVNVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVE
ILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDEN
MKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESI
KNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAISSNMREDI
TYLYKHPEGSDAERKAVETAAAHGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLMVSVML
INHSSSRRTVKLHLYLSVTFYTGVSGTIFKETKKEVELAPGASDRVTMPVAYKEYRPHLV
DQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVT
LTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQSFVPVRPGPRQLIASLDSPQLSQVHG
VIQVDVAPAPGDGGFFSDAGGDSHLGETIPMASRGGA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50164222
n/a
NameBDBM50164222
Synonyms:CHEMBL193212 | N-[6-(Imidazo[1,2-d][1,2,4]thiadiazol-3-ylamino)-hexyl]-2-nitro-benzenesulfonamide
TypeSmall organic molecule
Emp. Form.C16H20N6O4S2
Mol. Mass.424.498
SMILES[O-][N+](=O)c1ccccc1S(=O)(=O)NCCCCCCNc1n[s+]c2[n-]ccn12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: