| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanocortin receptor 5 |
|---|
| Ligand | BDBM50165930 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_303608 (CHEMBL829697) |
|---|
| Ki | >500±n/a nM |
|---|
| Citation |  Mayer, JP; Hsiung, HM; Flora, DB; Edwards, P; Smith, DP; Zhang, XY; Gadski, RA; Heiman, ML; Hertel, JL; Emmerson, PJ; Husain, S; O'brien, TP; Kahl, SD; Smiley, DL; Zhang, L; Dimarchi, RD; Yan, LZ Discovery of a beta-MSH-derived MC-4R selective agonist. J Med Chem48:3095-8 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanocortin receptor 5 |
|---|
| Name: | Melanocortin receptor 5 |
|---|
| Synonyms: | MC-2 | MC5-R | MC5R | MC5R_HUMAN | Melanocortin MC5 | Melanocortin receptor (M4 and M5) | Melanocortin receptor 5 | Melanocortin receptor 5 (MC5R) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 36612.92 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P33032 |
|---|
| Residue: | 325 |
|---|
| Sequence: | MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD
|
|
|
|---|
| BDBM50165930 |
|---|
| n/a |
|---|
| Name | BDBM50165930 |
|---|
| Synonyms: | Ac-YR[CEHdFRWC]-NH2 | CHEMBL264352 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C60H79N19O13S2 |
|---|
| Mol. Mass. | 1338.519 |
|---|
| SMILES | CC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]1CSSC[C@@H](NC(=O)[C@@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](Cc2cnc[nH]2)NC(=O)[C@@H](CCC(O)=O)NC1=O)C(N)=O |
|---|
| Structure | 
|
|---|
Search and Browse
