Reaction Details |
| Report a problem with these data |
Target | Melanocyte-stimulating hormone receptor |
---|
Ligand | BDBM50166525 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_303497 (CHEMBL839969) |
---|
Ki | 6800±n/a nM |
---|
Citation | Pontillo, J; Tran, JA; Markison, S; Joppa, M; Fleck, BA; Marinkovic, D; Arellano, M; Tucci, FC; Lanier, M; Nelson, J; Saunders, J; Hoare, SR; Foster, AC; Chen, C A potent and selective nonpeptide antagonist of the melanocortin-4 receptor induces food intake in satiated mice. Bioorg Med Chem Lett15:2541-6 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Melanocyte-stimulating hormone receptor |
---|
Name: | Melanocyte-stimulating hormone receptor |
Synonyms: | MC1-R | MC1R | MSH-R | MSHR | MSHR_HUMAN | Melanocortin MC1 | Melanocortin receptor (M1 and M4) | Melanocortin receptor 1 (MC-1) | Melanocortin receptor 1 (MC1-R) | Melanocortin receptor 1 (MC1R) |
Type: | Enzyme |
Mol. Mass.: | 34717.23 |
Organism: | Homo sapiens (Human) |
Description: | Q01726 |
Residue: | 317 |
Sequence: | MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGLVSLVENALVV
ATIAKNRNLHSPMYCFICCLALSDLLVSGSNVLETAVILLLEAGALVARAAVLQQLDNVI
DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVVFSTLFI
AYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGA
VTLTILLGIFFLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAF
HSQELRRTLKEVLTCSW
|
|
|
BDBM50166525 |
---|
n/a |
---|
Name | BDBM50166525 |
Synonyms: | 3-[(R)-1-(2,4-Dichloro-benzyl)-2-oxo-2-(4-{2-[(2-thiophen-2-yl-ethylamino)-methyl]-phenyl}-piperazin-1-yl)-ethyl]-1,1-dimethyl-urea | CHEMBL194987 |
Type | Small organic molecule |
Emp. Form. | C29H35Cl2N5O2S |
Mol. Mass. | 588.592 |
SMILES | CN(C)C(=O)N[C@H](Cc1ccc(Cl)cc1Cl)C(=O)N1CCN(CC1)c1ccccc1CNCCc1cccs1 |
Structure |
|