| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanocortin receptor 5 |
|---|
| Ligand | BDBM50166532 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_303498 (CHEMBL839970) |
|---|
| Ki | 350±n/a nM |
|---|
| Citation |  Pontillo, J; Tran, JA; Markison, S; Joppa, M; Fleck, BA; Marinkovic, D; Arellano, M; Tucci, FC; Lanier, M; Nelson, J; Saunders, J; Hoare, SR; Foster, AC; Chen, C A potent and selective nonpeptide antagonist of the melanocortin-4 receptor induces food intake in satiated mice. Bioorg Med Chem Lett15:2541-6 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanocortin receptor 5 |
|---|
| Name: | Melanocortin receptor 5 |
|---|
| Synonyms: | MC-2 | MC5-R | MC5R | MC5R_HUMAN | Melanocortin MC5 | Melanocortin receptor (M4 and M5) | Melanocortin receptor 5 | Melanocortin receptor 5 (MC5R) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 36612.92 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P33032 |
|---|
| Residue: | 325 |
|---|
| Sequence: | MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD
|
|
|
|---|
| BDBM50166532 |
|---|
| n/a |
|---|
| Name | BDBM50166532 |
|---|
| Synonyms: | 1-[(R)-1-(2,4-Dichloro-benzyl)-2-oxo-2-(4-{2-[(2-thiophen-2-yl-ethylamino)-methyl]-phenyl}-piperazin-1-yl)-ethyl]-3-(2-hydroxy-ethyl)-urea | CHEMBL195308 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H35Cl2N5O3S |
|---|
| Mol. Mass. | 604.591 |
|---|
| SMILES | OCCNC(=O)N[C@H](Cc1ccc(Cl)cc1Cl)C(=O)N1CCN(CC1)c1ccccc1CNCCc1cccs1 |
|---|
| Structure | 
|
|---|
Search and Browse
