Reaction Details |
| Report a problem with these data |
Target | Tryptase beta-2 |
---|
Ligand | BDBM50167514 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_302629 (CHEMBL839921) |
---|
Ki | 68±n/a nM |
---|
Citation | Hopkins, CR; Czekaj, M; Kaye, SS; Gao, Z; Pribish, J; Pauls, H; Liang, G; Sides, K; Cramer, D; Cairns, J; Luo, Y; Lim, HK; Vaz, R; Rebello, S; Maignan, S; Dupuy, A; Mathieu, M; Levell, J Design, synthesis, and biological activity of potent and selective inhibitors of mast cell tryptase. Bioorg Med Chem Lett15:2734-7 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Tryptase beta-2 |
---|
Name: | Tryptase beta-2 |
Synonyms: | TPS2 | TPSB2 | TRYB2_HUMAN | Tryptase | Tryptase II | Tryptase beta-1 | Tryptase-2 |
Type: | PROTEIN |
Mol. Mass.: | 30518.79 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_210702 |
Residue: | 275 |
Sequence: | MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCG
GSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGA
DIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKV
PIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAG
VVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
|
|
|
BDBM50167514 |
---|
n/a |
---|
Name | BDBM50167514 |
Synonyms: | CHEMBL370463 | [4-(3-Aminomethyl-phenyl)-piperidin-1-yl]-(1-butyl-7-methyl-1H-indol-3-yl)-methanone; TFA |
Type | Small organic molecule |
Emp. Form. | C26H33N3O |
Mol. Mass. | 403.5597 |
SMILES | CCCCn1cc(C(=O)N2CCC(CC2)c2cccc(CN)c2)c2cccc(C)c12 |
Structure |
|