| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Methionine aminopeptidase |
|---|
| Ligand | BDBM50170367 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_304984 (CHEMBL829421) |
|---|
| IC50 | 35±n/a nM |
|---|
| Citation |  Cui, YM; Huang, QQ; Xu, J; Chen, LL; Li, JY; Ye, QZ; Li, J; Nan, FJ Identification of potent type I MetAPs inhibitors by simple bioisosteric replacement. Part 2: SAR studies of 5-heteroalkyl substituted TCAT derivatives. Bioorg Med Chem Lett15:4130-5 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Methionine aminopeptidase |
|---|
| Name: | Methionine aminopeptidase |
|---|
| Synonyms: | EcMetAP | MAP1_ECOLI | Methionine Aminopeptidase (MAP) | Methionine aminopeptidase | Peptidase M | map |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 29326.96 |
|---|
| Organism: | Escherichia coli (strain K12) |
|---|
| Description: | Full-length untagged EcMAP was expressed in E. coli. |
|---|
| Residue: | 264 |
|---|
| Sequence: | MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACL
GYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTI
MGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEE
PQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVV
TDNGCEILTLRKDDTIPAIISHDE
|
|
|
|---|
| BDBM50170367 |
|---|
| n/a |
|---|
| Name | BDBM50170367 |
|---|
| Synonyms: | 5-[2-Methoxy-2-(2-methoxy-phenyl)-ethyl]-thiazole-4-carboxylic acid thiazol-2-ylamide | CHEMBL362123 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H17N3O3S2 |
|---|
| Mol. Mass. | 375.465 |
|---|
| SMILES | COC(Cc1scnc1C(=O)Nc1nccs1)c1ccccc1OC |
|---|
| Structure | 
|
|---|
Search and Browse
