| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tubulin beta chain [1-43] |
|---|
| Ligand | BDBM50170567 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_311661 (CHEMBL840833) |
|---|
| IC50 | 1300±n/a nM |
|---|
| Citation |  Romagnoli, R; Baraldi, PG; Jung, MK; Iaconinoto, MA; Carrion, MD; Remusat, V; Preti, D; Tabrizi, MA; Francesca, F; De Clercq, E; Balzarini, J; Hamel, E Synthesis and preliminary biological evaluation of new anti-tubulin agents containing different benzoheterocycles. Bioorg Med Chem Lett15:4048-52 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tubulin beta chain [1-43] |
|---|
| Name: | Tubulin beta chain [1-43] |
|---|
| Synonyms: | Beta tubulin | TBB_LEIME |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 4652.47 |
|---|
| Organism: | Leishmania donovani |
|---|
| Description: | ChEMBL_311916 |
|---|
| Residue: | 43 |
|---|
| Sequence: | MREIVSCQAGQCGNQIGSKFWEVIADEHGVDPTGSYQGDSDLQ
|
|
|
|---|
| BDBM50170567 |
|---|
| n/a |
|---|
| Name | BDBM50170567 |
|---|
| Synonyms: | (3-Amino-6-methyl-benzo[b]thiophen-2-yl)-(3,4,5-trimethoxy-phenyl)-methanone | 2-(3,4,5-trimethoxybenzoyl)-3-amino-6-methylbenzo[b]thiophene | CHEMBL190320 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H19NO4S |
|---|
| Mol. Mass. | 357.423 |
|---|
| SMILES | COc1cc(cc(OC)c1OC)C(=O)c1sc2cc(C)ccc2c1N |
|---|
| Structure | 
|
|---|
Search and Browse
