Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCOX-1
LigandBDBM50172473
Substrate/Competitorn/a
Meas. Tech.ChEMBL_321330
IC50 44000±n/a nM
Citation Peretto IRadaelli SParini CZandi MRaveglia LFDondio GFontanella LMisiano PBigogno CRizzi ARiccardi BBiscaioli MMarchetti SPuccini PCatinella SRondelli ICenacchi VBolzoni PTCaruso PVilletti GFacchinetti FDel Giudice EMoretto NImbimbo BP Synthesis and biological activity of flurbiprofen analogues as selective inhibitors of beta-amyloid(1)(-)(42) secretion. J Med Chem 48:5705-20 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
COX-1
Name:Cyclooxygenase
Synonyms:Cyclooxygenase-1 | Prostaglandin G/H synthase (cyclooxygenase)
Type:Enzyme Catalytic Domain
Mol. Mass.:69033.56
Organism:RAT
Description:COX-1 0 RAT::Q63921
Residue:602
Sequence:
MSRRSLSLQFPLLLLLLLLPPPPVLLTDAGVPSPVNPCCYYPCQNQGVCVRFGLDHYQCD
CTRTGYSGPNCTIPEIWTWLRSSLRPSPSFTHFLLTHGYWIWEFVNATFIREVLMRLVIT
VRSNLIPSPPTYNTAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDIHLLA
QRLLLRREFIPGPQGTNVLFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDSL
ERQYHLRLFKDGKLKYQVLDGEVYPPSVEQASVLMRYPPGVPPEKQMAVGQEVFGLLPGL
MLFSTIWLREHNRVCDLLKEEHPTWDDEQLFQTTRLILIGETIKIIIEEYVQHLSGYFLQ
LKFDPELLFRAQFQYRNRIALEFNHLYHWHPLMPDSFQVGSQEYSYEQFLFNTSMLVDYG
VEALVDAFSRQRAGRIGGGRNFDYHVLHVAEDVIKESREMRLQSFNEYRKRFGLKPYTSF
QEFTGEKEMAAELEELYGDIDALEFYPGLMLEKCQPNSLFGESMIEMGAPFSLKGLLGNP
ICSPEYWKPSTFGGDVGFNIVNTASLKKLVCLNTKTCPYVSFRVPDYPGDDGSVFVRPST
EL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50172473
n/a
NameBDBM50172473
Synonyms:(-)-(2R)-2-(2-fluorobiphenyl-4-yl)propanoic acid | (2R)-2-(2-fluoro-[1,1'-biphenyl-4-yl])propanoic acid | (2R)-2-(2-fluorobiphenyl-4-yl)propanoic acid | (R)-2-fluoro-alpha-methyl(1,1'-biphenyl)-4-acetic acid | (R)-FLURBIPROFEN | CHEMBL190083 | Flurizan | Tarenflurbil
TypeSmall organic molecule
Emp. Form.C15H13FO2
Mol. Mass.244.2609
SMILESC[C@@H](C(O)=O)c1ccc(c(F)c1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: