| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 11-beta-hydroxysteroid dehydrogenase type 2 |
|---|
| Ligand | BDBM50174289 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_326696 (CHEMBL868715) |
|---|
| IC50 | >4000±n/a nM |
|---|
| Citation |  Gu, X; Dragovic, J; Koo, GC; Koprak, SL; LeGrand, C; Mundt, SS; Shah, K; Springer, MS; Tan, EY; Thieringer, R; Hermanowski-Vosatka, A; Zokian, HJ; Balkovec, JM; Waddell, ST Discovery of 4-heteroarylbicyclo[2.2.2]octyltriazoles as potent and selective inhibitors of 11beta-HSD1: novel therapeutic agents for the treatment of metabolic syndrome. Bioorg Med Chem Lett15:5266-9 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 11-beta-hydroxysteroid dehydrogenase type 2 |
|---|
| Name: | 11-beta-hydroxysteroid dehydrogenase type 2 |
|---|
| Synonyms: | 11-DH2 | 11-beta-HSD2 | 11-beta-Hydroxysteroid Dehydrogenase 2 (11-beta-HSD2) | 11-beta-hydroxysteroid dehydrogenase type 2 | Corticosteroid 11-beta-dehydrogenase isozyme 2 | DHI2_MOUSE | Hsd11b2 | Hsd11k | NAD-dependent 11-beta-hydroxysteroid dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 42201.46 |
|---|
| Organism: | Mus musculus (mouse) |
|---|
| Description: | Purified recombinant mouse 11beta-HSD2. |
|---|
| Residue: | 386 |
|---|
| Sequence: | MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALVV
LAGAGWIALSRLARPPRLPVATRAVLITGCDTGFGKETAKKLDAMGFTVLATVLDLNSPG
ALELRDLCSPRLKLLQMDLTKAEDISRVLEITKAHTASTGLWGLVNNAGLNIVVADVELS
PVATFRKCMEVNFFGALELTKGLLPLLRHSRGRIVTVGSPAGDMPYPCLAAYGTSKAAIA
LLMDTFGCELLPWGIKVSIIKPGCFKTDAVTNVNLWEKRKQLLLANIPRELLQAYGEDYI
EHVHGQFLNSLRMALPDLSPVVDAIIDALLAAQPRSRYYPGRGLGLMYFIHHYLPEGLRR
CFLQNFFINHLLPRALRPGQHGPAPA
|
|
|
|---|
| BDBM50174289 |
|---|
| n/a |
|---|
| Name | BDBM50174289 |
|---|
| Synonyms: | 3-(4-(3-(cyclopropylmethyl)-1,2,4-oxadiazol-5-yl)bicyclo[2.2.2]octan-1-yl)-5,6,7,8,9,10-hexahydro-[1,2,4]triazolo[4,3-a]azocine | CHEMBL200365 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H31N5O |
|---|
| Mol. Mass. | 381.5144 |
|---|
| SMILES | C(C1CC1)c1noc(n1)C12CCC(CC1)(CC2)c1nnc2CCCCCCn12 |
|---|
| Structure | 
|
|---|
Search and Browse
