| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Holo-[acyl-carrier-protein] synthase |
|---|
| Ligand | BDBM25902 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_326222 (CHEMBL867576) |
|---|
| IC50 | 12700±n/a nM |
|---|
| Citation |  Joseph-McCarthy, D; Parris, K; Huang, A; Failli, A; Quagliato, D; Dushin, EG; Novikova, E; Severina, E; Tuckman, M; Petersen, PJ; Dean, C; Fritz, CC; Meshulam, T; DeCenzo, M; Dick, L; McFadyen, IJ; Somers, WS; Lovering, F; Gilbert, AM Use of structure-based drug design approaches to obtain novel anthranilic acid acyl carrier protein synthase inhibitors. J Med Chem48:7960-9 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Holo-[acyl-carrier-protein] synthase |
|---|
| Name: | Holo-[acyl-carrier-protein] synthase |
|---|
| Synonyms: | ACPS_BACSU | Holo-[acyl-carrieir-protein] synthase | acpS | ydcB |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 13724.66 |
|---|
| Organism: | Bacillus subtilis |
|---|
| Description: | ChEMBL_326222 |
|---|
| Residue: | 121 |
|---|
| Sequence: | MIYGIGLDITELKRIASMAGRQKRFAERILTRSELDQYYELSEKRKNEFLAGRFAAKEAF
SKAFGTGIGRQLSFQDIEIRKDQNGKPYIICTKLSQAAVHVSITHTKEYAAAQVVIERLS
S
|
|
|
|---|
| BDBM25902 |
|---|
| n/a |
|---|
| Name | BDBM25902 |
|---|
| Synonyms: | 4-chloro-2-[(furan-2-ylmethyl)amino]-5-sulfamoylbenzoic acid | CHEMBL35 | Frusemide | Furanthril | Furosemide | Furosemide (3) | Furosemide, 4 | Lasix | US10172837, Furosemide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H11ClN2O5S |
|---|
| Mol. Mass. | 330.744 |
|---|
| SMILES | NS(=O)(=O)c1cc(C(O)=O)c(NCc2ccco2)cc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
