Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50178757 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_326435 (CHEMBL867593) |
---|
Ki | 0.092±n/a nM |
---|
Citation | Li, T; Fujita, Y; Shiotani, K; Miyazaki, A; Tsuda, Y; Ambo, A; Sasaki, Y; Jinsmaa, Y; Marczak, E; Bryant, SD; Salvadori, S; Lazarus, LH; Okada, Y Potent Dmt-Tic pharmacophoric delta- and mu-opioid receptor antagonists. J Med Chem48:8035-44 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40465.04 |
Organism: | Rattus norvegicus (rat) |
Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
Residue: | 372 |
Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50178757 |
---|
n/a |
---|
Name | BDBM50178757 |
Synonyms: | 3-(Dmt-Tic-NH-butyl)-6-(Dmt-Tic-NH-propyl)-2-(1H)-pyrazinone | CHEMBL370398 |
Type | Small organic molecule |
Emp. Form. | C54H66N8O7 |
Mol. Mass. | 939.1512 |
SMILES | Cc1cc(O)cc(C)c1C[C@H](N)C(=O)N1Cc2ccccc2CC1C(=O)NCCCCc1nc(C)c(CCCNC(=O)C2Cc3ccccc3CN2C(=O)[C@@H](N)Cc2c(C)cc(O)cc2C)[nH]c1=O |
Structure |
|