| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50178765 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_326435 (CHEMBL867593) |
|---|
| Ki | 0.124±n/a nM |
|---|
| Citation |  Li, T; Fujita, Y; Shiotani, K; Miyazaki, A; Tsuda, Y; Ambo, A; Sasaki, Y; Jinsmaa, Y; Marczak, E; Bryant, SD; Salvadori, S; Lazarus, LH; Okada, Y Potent Dmt-Tic pharmacophoric delta- and mu-opioid receptor antagonists. J Med Chem48:8035-44 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40465.04 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50178765 |
|---|
| n/a |
|---|
| Name | BDBM50178765 |
|---|
| Synonyms: | 1,4-bis-(Dmt-Tic-amino)butane | CHEMBL370197 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C46H56N6O6 |
|---|
| Mol. Mass. | 788.9734 |
|---|
| SMILES | Cc1cc(O)cc(C)c1C[C@H](N)C(=O)N1Cc2ccccc2CC1C(=O)NCCCCNC(=O)C1Cc2ccccc2CN1C(=O)[C@@H](N)Cc1c(C)cc(O)cc1C |
|---|
| Structure | 
|
|---|
Search and Browse
