Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM8125 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2234234 (CHEMBL5148006) |
---|
IC50 | 0.510000±n/a nM |
---|
Citation | Hu, S; Ma, L; Dong, B; Shan, Q; Zhou, J; Zhang, G; Wang, M; Cen, S; Zhu, M; Wang, J; Wang, Y A kind of HIV-1 protease inhibitors containing phenols with antiviral activity against DRV-resistant variants. Bioorg Med Chem64:0 (2022) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM8125 |
---|
n/a |
---|
Name | BDBM8125 |
Synonyms: | (3R,3aS,6aR)-hexahydrofuro[2,3-b]furan-3-yl N-[(2S,3R)-4-[(4-aminobenzene)(2-methylpropyl)sulfonamido]-3-hydroxy-1-phenylbutan-2-yl]carbamate | CHEMBL1323 | Darunavir | Darunavir (DRV) | TMC-114 | UIC-94017 | US10806794, Compound Darunavir |
Type | Small organic molecule |
Emp. Form. | C27H37N3O7S |
Mol. Mass. | 547.664 |
SMILES | [H][C@@]1(CO[C@@]2([H])OCC[C@@]12[H])OC(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN(CC(C)C)S(=O)(=O)c1ccc(N)cc1 |r| |
Structure |
|