| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Major prion protein |
|---|
| Ligand | BDBM50015214 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2235420 (CHEMBL5149192) |
|---|
| IC50 | 95±n/a nM |
|---|
| Citation |  Colini Baldeschi, A; Zattoni, M; Vanni, S; Nikolic, L; Ferracin, C; La Sala, G; Summa, M; Bertorelli, R; Bertozzi, SM; Giachin, G; Carloni, P; Bolognesi, ML; De Vivo, M; Legname, G Innovative Non-PrP-Targeted Drug Strategy Designed to Enhance Prion Clearance. J Med Chem65:8998-9010 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Major prion protein |
|---|
| Name: | Major prion protein |
|---|
| Synonyms: | PRIO_MOUSE | Prion protein | Prn-p | Prnp | Prp |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27989.70 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_691098 |
|---|
| Residue: | 254 |
|---|
| Sequence: | MANLGYWLLALFVTMWTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGTWGQPH
GGGWGQPHGGSWGQPHGGSWGQPHGGGWGQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAV
VGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVN
ITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRSSSTVLFSSPP
VILLISFLIFLIVG
|
|
|
|---|
| BDBM50015214 |
|---|
| n/a |
|---|
| Name | BDBM50015214 |
|---|
| Synonyms: | 6-chloro-2-methoxy-9-acridinyl(4-diethylamino-1-methylbutyl)amine | 6-chloro-N-(5-(diethylamino)pentan-2-yl)-2-methoxyacridin-9-amine | CHEMBL7568 | N'-(6-chloro-2-methoxy-acridin-9-yl)-N,N-diethyl-pentane-1,4-diamine | N*4*-(6-Chloro-2-methoxy-acridin-9-yl)-N*1*,N*1*-diethyl-pentane-1,4-diamine | N*4*-(6-Chloro-2-methoxy-acridin-9-yl)-N*1*,N*1*-diethyl-pentane-1,4-diamine (Mepacrine) | N*4*-(6-Chloro-2-methoxy-acridin-9-yl)-N*1*,N*1*-diethyl-pentane-1,4-diamine ; (mepacrine) | N-(4-Hydroxy-phenyl)-acetamide | cid_237 | quinacrine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H30ClN3O |
|---|
| Mol. Mass. | 399.957 |
|---|
| SMILES | CCN(CC)CCCC(C)Nc1c2ccc(Cl)cc2nc2ccc(OC)cc12 |
|---|
| Structure | 
|
|---|
Search and Browse
