| Reaction Details |
|---|
 | Report a problem with these data |
| Target | B1 bradykinin receptor |
|---|
| Ligand | BDBM50182241 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_344573 (CHEMBL866612) |
|---|
| IC50 | 120±n/a nM |
|---|
| Citation |  Fotsch, C; Biddlecome, G; Biswas, K; Chen, JJ; D'Amico, DC; Groneberg, RD; Han, NB; Hsieh, FY; Kamassah, A; Kumar, G; Lester-Zeiner, D; Liu, Q; Mareska, DA; Riahi, BB; Wang, YJ; Yang, K; Zhan, J; Zhu, J; Johnson, E; Ng, G; Askew, BC A new class of bradykinin 1 receptor antagonists containing the piperidine acetic acid tetralin core. Bioorg Med Chem Lett16:2071-5 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| B1 bradykinin receptor |
|---|
| Name: | B1 bradykinin receptor |
|---|
| Synonyms: | B1 BRADYKININ | B1 bradykinin receptor | B1R | BDKRB1 | BK-1 receptor | BKRB1_HUMAN | BRADYB1 | Bradykinin B1 receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 40508.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P46663 |
|---|
| Residue: | 353 |
|---|
| Sequence: | MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
|
|
|
|---|
| BDBM50182241 |
|---|
| n/a |
|---|
| Name | BDBM50182241 |
|---|
| Synonyms: | CHEMBL381964 | N-((R)-6-((tert-butylamino)methyl)-1,2,3,4-tetrahydronaphthalen-1-yl)-2-((S)-1-(3-chlorophenylsulfonyl)piperidin-2-yl)acetamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H38ClN3O3S |
|---|
| Mol. Mass. | 532.138 |
|---|
| SMILES | CC(C)(C)NCc1ccc2[C@@H](CCCc2c1)NC(=O)C[C@@H]1CCCCN1S(=O)(=O)c1cccc(Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
