| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Disintegrin and metalloproteinase domain-containing protein 17 |
|---|
| Ligand | BDBM50183729 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_354453 (CHEMBL865119) |
|---|
| IC50 | 2.6±n/a nM |
|---|
| Citation |  Gilmore, JL; King, BW; Harris, C; Maduskuie, T; Mercer, SE; Liu, RQ; Covington, MB; Qian, M; Ribadeneria, MD; Vaddi, K; Trzaskos, JM; Newton, RC; Decicco, CP; Duan, JJ Synthesis and structure-activity relationship of a novel, achiral series of TNF-alpha converting enzyme inhibitors. Bioorg Med Chem Lett16:2699-704 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Disintegrin and metalloproteinase domain-containing protein 17 |
|---|
| Name: | Disintegrin and metalloproteinase domain-containing protein 17 |
|---|
| Synonyms: | A disintegrin and metalloproteinase domain 17 | ADA17_PIG | ADAM 17 | ADAM17 | Snake venom-like protease | TACE | TNF-alpha-Converting Enzyme |
|---|
| Type: | Metalloprotease |
|---|
| Mol. Mass.: | 12197.99 |
|---|
| Organism: | Sus scrofa (pig) |
|---|
| Description: | Partially purified TACE was obtained from porcine spleen. |
|---|
| Residue: | 112 |
|---|
| Sequence: | MLREQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPIGK
KNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNE
|
|
|
|---|
| BDBM50183729 |
|---|
| n/a |
|---|
| Name | BDBM50183729 |
|---|
| Synonyms: | CHEMBL207180 | N-(4-(2-(hydroxyamino)-2-oxoethyl)-1-neopentylpiperidin-4-yl)-4-((2-methylquinolin-4-yl)methoxy)benzamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H38N4O4 |
|---|
| Mol. Mass. | 518.6471 |
|---|
| SMILES | Cc1cc(COc2ccc(cc2)C(=O)NC2(CC(=O)NO)CCN(CC(C)(C)C)CC2)c2ccccc2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
