Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase C alpha type
LigandBDBM50184382
Substrate/Competitorn/a
Meas. Tech.ChEMBL_338717
Ki 6.2±n/a nM
Citation Lee JKang JHHan KCKim YKim SYYoun HSMook-Jung IKim HLo Han JHHa HJKim YHMarquez VELewin NEPearce LVLundberg DJBlumberg PM Branched diacylglycerol-lactones as potent protein kinase C ligands and alpha-secretase activators. J Med Chem 49:2028-36 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein kinase C alpha type
Name:PKC alpha and beta-2
Synonyms:PKC alpha | PKC-A | PKC-alpha | Protein Kinase C- alpha | Protein kinase C alpha | Protein kinase C alpha (PKCa) | Protein kinase C alpha type (PKC-A) | Protein kinase C alpha type (PRKCA) | Proto-oncogene c-RAF | RAF proto-oncogene serine/threonine-protein kinase
Type:Enzyme
Mol. Mass.:76755.65
Organism:Homo sapiens (Human)
Description:The recombinant human PKC enzymes were produced using a baculovirus expression system in SF9 cells
Residue:672
Sequence:
MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50184382
n/a
NameBDBM50184382
Synonyms:5-hexanoyloxymethyl-5-hydroxymethyl-3-[(E)-3-isobutyl-5-methylhexylidene]tetrahydro-2-furanone | CHEMBL203521
TypeSmall organic molecule
Emp. Form.C23H40O5
Mol. Mass.396.5607
SMILESCCCCCC(=O)OCC1(CO)C\C(=C/CC(CC(C)C)CC(C)C)C(=O)O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: