| Reaction Details |
|---|
 | Report a problem with these data |
| Target | RNA-directed RNA polymerase |
|---|
| Ligand | BDBM50222317 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_369597 (CHEMBL865370) |
|---|
| IC50 | 10±n/a nM |
|---|
| Citation |  Chris Krueger, A; Madigan, DL; Jiang, WW; Kati, WM; Liu, D; Liu, Y; Maring, CJ; Masse, S; McDaniel, KF; Middleton, T; Mo, H; Molla, A; Montgomery, D; Pratt, JK; Rockway, TW; Zhang, R; Kempf, DJ Inhibitors of HCV NS5B polymerase: synthesis and structure-activity relationships of N-alkyl-4-hydroxyquinolon-3-yl-benzothiadiazine sulfamides. Bioorg Med Chem Lett16:3367-70 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| RNA-directed RNA polymerase |
|---|
| Name: | RNA-directed RNA polymerase |
|---|
| Synonyms: | Hepatitis C virus NS5B RNA-dependent RNA polymerase | NS5B protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25173.95 |
|---|
| Organism: | Hepatitis C virus |
|---|
| Description: | Q8JXU8 |
|---|
| Residue: | 229 |
|---|
| Sequence: | RTEEAIYQCCDLDPQARVAIRSLTERLYVGGPLTNSRGENCGYRRRASGVLTTSCGNTLT
CYIKAQAACRAAGRQDCTMLVCGDDLVVICESAGVQEDAASLRAFTEAMTRYSAPPGDPP
QPEYDLELITSCSSNVSVAHDGAGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIM
FAPTLWVRMIMLTHFFSVLIARDQLEQALDCEIYGACYSIEPLLPPIIQ
|
|
|
|---|
| BDBM50222317 |
|---|
| n/a |
|---|
| Name | BDBM50222317 |
|---|
| Synonyms: | CHEMBL394002 | N-[(4-methoxyphenyl)methyl]({3-[4-hydroxy-1-(3-methylbutyl)-2-oxo-1,2-dihydro-1,8-naphthyridin-3-yl]-1,1-dioxo-4H-1,2,4-benzothiadiazin-7-yl}amino)sulfonamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H30N6O7S2 |
|---|
| Mol. Mass. | 626.704 |
|---|
| SMILES | COc1ccc(CNS(=O)(=O)Nc2ccc3N=C(NS(=O)(=O)c3c2)c2c(O)c3cccnc3n(CCC(C)C)c2=O)cc1 |c:16| |
|---|
| Structure | 
|
|---|
Search and Browse
