| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanin-concentrating hormone receptor 2 |
|---|
| Ligand | BDBM50186770 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_376789 (CHEMBL866614) |
|---|
| Ki | >3000±n/a nM |
|---|
| Citation |  Wu, WL; Burnett, DA; Spring, R; Qiang, L; Sasikumar, TK; Domalski, MS; Greenlee, WJ; O'Neill, K; Hawes, BE Synthesis and structure-activity relationships of piperidine-based melanin-concentrating hormone receptor 1 antagonists. Bioorg Med Chem Lett16:3668-73 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanin-concentrating hormone receptor 2 |
|---|
| Name: | Melanin-concentrating hormone receptor 2 |
|---|
| Synonyms: | GPR145 | MCHR2 | MCHR2_HUMAN | Melanin Concentrating Hormone 2 | Melanin-concentrating hormone receptor | Melanin-concentrating hormone receptor 2 | SLT |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 38862.16 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Melanin Concentrating Hormone 2 GPR145 HUMAN::Q969V1 |
|---|
| Residue: | 340 |
|---|
| Sequence: | MNPFHASCWNTSAELLNKSWNKEFAYQTASVVDTVILPSMIGIICSTGLVGNILIVFTII
RSRKKTVPDIYICNLAVADLVHIVGMPFLIHQWARGGEWVFGGPLCTIITSLDTCNQFAC
SAIMTVMSVDRYFALVQPFRLTRWRTRYKTIRINLGLWAASFILALPVWVYSKVIKFKDG
VESCAFDLTSPDDVLWYTLYLTITTFFFPLPLILVCYILILCYTWEMYQQNKDARCCNPS
VPKQRVMKLTKMVLVLVVVFILSAAPYHVIQLVNLQMEQPTLAFYVGYYLSICLSYASSS
INPFLYILLSGNFQKRLPQIQRRATEKEINNMGNTLKSHF
|
|
|
|---|
| BDBM50186770 |
|---|
| n/a |
|---|
| Name | BDBM50186770 |
|---|
| Synonyms: | 2-[4-(3'-cyano-biphenyl-4-yl)-1-cyclopentyl-piperidin-4-ylamino]-N-(3,5-difluoro-phenyl)-acetamide | CHEMBL209828 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H32F2N4O |
|---|
| Mol. Mass. | 514.6088 |
|---|
| SMILES | Fc1cc(F)cc(NC(=O)CNC2(CCN(CC2)C2CCCC2)c2ccc(cc2)-c2cccc(c2)C#N)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
