| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 1D |
|---|
| Ligand | BDBM50187377 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_357760 (CHEMBL859771) |
|---|
| Ki | >2000±n/a nM |
|---|
| Citation |  Becker, OM; Dhanoa, DS; Marantz, Y; Chen, D; Shacham, S; Cheruku, S; Heifetz, A; Mohanty, P; Fichman, M; Sharadendu, A; Nudelman, R; Kauffman, M; Noiman, S An integrated in silico 3D model-driven discovery of a novel, potent, and selective amidosulfonamide 5-HT1A agonist (PRX-00023) for the treatment of anxiety and depression. J Med Chem49:3116-35 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 1D |
|---|
| Name: | 5-hydroxytryptamine receptor 1D |
|---|
| Synonyms: | 5-HT-1D | 5-HT-1D-alpha | 5-HT1D | 5-hydroxytryptamine receptor 1D (5-HT1D) | 5HT1D_HUMAN | HTR1D | HTR1DA | HTRL | Serotonin (5-HT) receptor | Serotonin Receptor 1D |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 41920.63 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Receptor binding assays were performed using human clone stably expressed in CHO cells. |
|---|
| Residue: | 377 |
|---|
| Sequence: | MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAK
AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFT
TAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT
KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFQKIVPFRKAS
|
|
|
|---|
| BDBM50187377 |
|---|
| n/a |
|---|
| Name | BDBM50187377 |
|---|
| Synonyms: | CHEMBL209821 | N-(3-(4-(4-(cyclohexylmethylsulfonamido)butyl)piperazin-1-yl)phenyl)acetamide | N-{3-[4-(4-cyclohexylmethanesulfonylamino-butyl)-piperazin-1-yl]-phenyl}-acetamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H38N4O3S |
|---|
| Mol. Mass. | 450.638 |
|---|
| SMILES | CC(=O)Nc1cccc(c1)N1CCN(CCCCNS(=O)(=O)CC2CCCCC2)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
