| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Thromboxane A2 receptor |
|---|
| Ligand | BDBM50188610 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_364276 (CHEMBL863214) |
|---|
| IC50 | 1.52±n/a nM |
|---|
| Citation |  Hanson, J; Reynaud, D; Qiao, N; Devel, P; Moray, AL; Renard, JF; Kelley, LP; Winum, JY; Montero, JL; Kinsella, BT; Pirotte, B; Pace-Asciak, CR; Dogné, JM Synthesis and pharmacological evaluation of novel nitrobenzenic thromboxane modulators as antiplatelet agents acting on both the alpha and beta isoforms of the human thromboxane receptor. J Med Chem49:3701-9 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Thromboxane A2 receptor |
|---|
| Name: | Thromboxane A2 receptor |
|---|
| Synonyms: | Prostanoid TP receptor | TA2R_HUMAN | TBXA2R | TXA2-R | Thromboxane | Thromboxane A2 receptor | Thromboxane Beta |
|---|
| Type: | Enyzme |
|---|
| Mol. Mass.: | 37445.28 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P21731 |
|---|
| Residue: | 343 |
|---|
| Sequence: | MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL
LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG
SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE
VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
|
|
|
|---|
| BDBM50188610 |
|---|
| n/a |
|---|
| Name | BDBM50188610 |
|---|
| Synonyms: | CHEMBL208543 | N-cyclohexyl-N'-[2-(4-methylphenoxy)-5-nitrobenzenesulfonyl]urea |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H23N3O6S |
|---|
| Mol. Mass. | 433.478 |
|---|
| SMILES | Cc1ccc(Oc2ccc(cc2S(=O)(=O)NC(=O)NC2CCCCC2)[N+]([O-])=O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
