Reaction Details |
| Report a problem with these data |
Target | Thromboxane A2 receptor |
---|
Ligand | BDBM50188611 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_364276 (CHEMBL863214) |
---|
IC50 | 2.5±n/a nM |
---|
Citation | Hanson, J; Reynaud, D; Qiao, N; Devel, P; Moray, AL; Renard, JF; Kelley, LP; Winum, JY; Montero, JL; Kinsella, BT; Pirotte, B; Pace-Asciak, CR; Dogné, JM Synthesis and pharmacological evaluation of novel nitrobenzenic thromboxane modulators as antiplatelet agents acting on both the alpha and beta isoforms of the human thromboxane receptor. J Med Chem49:3701-9 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Thromboxane A2 receptor |
---|
Name: | Thromboxane A2 receptor |
Synonyms: | Prostanoid TP receptor | TA2R_HUMAN | TBXA2R | TXA2-R | Thromboxane | Thromboxane A2 receptor | Thromboxane Beta |
Type: | Enyzme |
Mol. Mass.: | 37445.28 |
Organism: | Homo sapiens (Human) |
Description: | P21731 |
Residue: | 343 |
Sequence: | MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL
LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG
SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE
VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
|
|
|
BDBM50188611 |
---|
n/a |
---|
Name | BDBM50188611 |
Synonyms: | CHEMBL211008 | N-n-heptyl-N'-[2-(cyclohexylamino)-5-nitrobenzenesulfonyl]urea |
Type | Small organic molecule |
Emp. Form. | C20H32N4O5S |
Mol. Mass. | 440.557 |
SMILES | CCCCCCCNC(=O)NS(=O)(=O)c1cc(ccc1NC1CCCCC1)[N+]([O-])=O |
Structure |
|