| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Ligand | BDBM50607118 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2262142 (CHEMBL5217153) |
|---|
| IC50 | 400±n/a nM |
|---|
| Citation |  He, R; Wang, J; Yu, ZH; Moyers, JS; Michael, MD; Durham, TB; Cramer, JW; Qian, Y; Lin, A; Wu, L; Noinaj, N; Barrett, DG; Zhang, ZY Structure-Based Design of Active-Site-Directed, Highly Potent, Selective, and Orally Bioavailable Low-Molecular-Weight Protein Tyrosine Phosphatase Inhibitors. J Med Chem65:13892-13909 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Name: | Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Synonyms: | 3.1.3.2 | 3.1.3.48 | ACP1 | Adipocyte acid phosphatase | LMW-PTP | LMW-PTPase | LMWPTP | Low molecular weight cytosolic acid phosphatase | PPAC_HUMAN | Red cell acid phosphatase 1 | low molecular weight phosphotyrosine protein phosphatase isoform c |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 18042.81 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P24666 |
|---|
| Residue: | 158 |
|---|
| Sequence: | MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRG
QSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
|
|
|
|---|
| BDBM50607118 |
|---|
| n/a |
|---|
| Name | BDBM50607118 |
|---|
| Synonyms: | CHEMBL5219065 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H7N3O6S2 |
|---|
| Mol. Mass. | 317.298 |
|---|
| SMILES | OS(=O)(=O)CC(=O)Nc1nc2cc(ccc2s1)[N+]([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
