Reaction Details |
| Report a problem with these data |
Target | Integrase |
---|
Ligand | BDBM50115579 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_371483 (CHEMBL862913) |
---|
IC50 | >333000±n/a nM |
---|
Citation | Sechi, M; Bacchi, A; Carcelli, M; Compari, C; Duce, E; Fisicaro, E; Rogolino, D; Gates, P; Derudas, M; Al-Mawsawi, LQ; Neamati, N From ligand to complexes: inhibition of human immunodeficiency virus type 1 integrase by beta-diketo acid metal complexes. J Med Chem49:4248-60 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Integrase |
---|
Name: | Integrase |
Synonyms: | Human immunodeficiency virus type 1 integrase |
Type: | PROTEIN |
Mol. Mass.: | 32231.48 |
Organism: | Human immunodeficiency virus 1 |
Description: | ChEMBL_90865 |
Residue: | 288 |
Sequence: | FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED
|
|
|
BDBM50115579 |
---|
n/a |
---|
Name | BDBM50115579 |
Synonyms: | (Z)-2-hydroxy-4-oxo-4-phenyl-but-2-enoic acid | 2-Hydroxy-4-oxo-4-phenyl-but-2-enoic acid | 2-Hydroxy-4-oxo-4-phenyl-but-2-enoic acid (0.25H2O) | CHEMBL16326 | CHEMBL19332 | CHEMBL467389 | Sacchettini_CTRL |
Type | Small organic molecule |
Emp. Form. | C10H8O4 |
Mol. Mass. | 192.1681 |
SMILES | OC(=O)C(=O)CC(=O)c1ccccc1 |
Structure |
|