| Reaction Details |
|---|
 | Report a problem with these data |
| Target | GTPase KRas |
|---|
| Ligand | BDBM50607572 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2262965 (CHEMBL5217976) |
|---|
| Kd | <10000±n/a nM |
|---|
| Citation |  Bröker, J; Waterson, AG; Smethurst, C; Kessler, D; Böttcher, J; Mayer, M; Gmaschitz, G; Phan, J; Little, A; Abbott, JR; Sun, Q; Gmachl, M; Rudolph, D; Arnhof, H; Rumpel, K; Savarese, F; Gerstberger, T; Mischerikow, N; Treu, M; Herdeis, L; Wunberg, T; Gollner, A; Weinstabl, H; Mantoulidis, A; Krämer, O; McConnell, DB; W Fesik, S Fragment Optimization of Reversible Binding to the Switch II Pocket on KRAS Leads to a Potent, In Vivo Active KRAS J Med Chem65:14614-14629 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| GTPase KRas |
|---|
| Name: | GTPase KRas |
|---|
| Synonyms: | GTPase KRas, N-terminally processed | K-Ras 2 | KRAS | KRAS2 | Ki-Ras | RASK2 | RASK_HUMAN | c-K-ras | c-Ki-ras |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 21656.10 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1476955 |
|---|
| Residue: | 189 |
|---|
| Sequence: | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIIM
|
|
|
|---|
| BDBM50607572 |
|---|
| n/a |
|---|
| Name | BDBM50607572 |
|---|
| Synonyms: | CHEMBL5220361 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H17N5OS |
|---|
| Mol. Mass. | 351.425 |
|---|
| SMILES | C[C@@]1(CCCc2sc(N)c(C#N)c12)c1nc(no1)-c1cccc(N)c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
